PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00424g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 378aa    MW: 42344.1 Da    PI: 7.499
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00424g00110.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.2e-32227280255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Peaxi162Scf00424g00110.1 227 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 280
                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15224280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28225280IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23227280IPR006447Myb domain, plants
PfamPF002492.0E-7228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MPLEGVFVQT PSSSKQIPDL SLHISPPNSS STSSSCNSIS ELLAANCELS LAHPTTINEE  60
NNLFYGLEKR SFTRNPLAPQ NNYMFQQSYN QMNHINNHGV SSLFEDVSSD GLRPIKGIPI  120
YHQNGSFPFL GLDYSTSREK DPKRCFYPTS SSNTSSTICS PFFNGASTLD HLSSTLPYRI  180
PVTNRFHHQQ NNFGVGLGPA HHEVSSHSMM RSRFLPKFPA RRSMRAPRMR WTTSLHARFV  240
HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKPAAS SGQSDGSGEE  300
DLLAIDSSTR ERWSQANFND TNGLIRSSSF PSQQRSSHQI EECDYSRPLS YGGCSLDQKY  360
PSLEFTLGRP DWVEKEHD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784258.11e-159PREDICTED: transcription repressor KAN1-like isoform X2
RefseqXP_016512530.11e-159PREDICTED: transcription repressor KAN1-like isoform X2
TrEMBLM1A9V11e-140M1A9V1_SOLTU; Uncharacterized protein
TrEMBLM1A9V21e-140M1A9V2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000179811e-139(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-42G2-like family protein